Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries) |
Domain d4e1oe1: 4e1o E:2-477 [201769] Other proteins in same PDB: d4e1oa2, d4e1ob2, d4e1oc2, d4e1od2, d4e1oe2, d4e1of2 automated match to d4e1oc_ complexed with plp, pvh |
PDB Entry: 4e1o (more details), 1.8 Å
SCOPe Domain Sequences for d4e1oe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e1oe1 c.67.1.0 (E:2-477) automated matches {Human (Homo sapiens) [TaxId: 9606]} mepeeyrergremvdyicqylstvrerrvtpdvqpgylraqlpesapedpdswdsifgdi eriimpgvvhwqsphmhayypaltswpsllgdmladainclgftwasspactelemnvmd wlakmlglpehflhhhpssqgggvlqstvsestliallaarknkilemktsepdadessl narlvayasdqahssvekaglislvkmkflpvddnfslrgealqkaieedkqrglvpvfv catlgttgvcafdclselgpicareglwlhidaayagtaflcpefrgflkgieyadsftf npskwmmvhfdctgfwvkdkyklqqtfsvnpiylrhansgvatdfmhwqiplsrrfrsvk lwfvirsfgvknlqahvrhgtemakyfeslvrndpsfeipakrhlglvvfrlkgpnslte nvlkeiakagrlflipatiqdkliirftvtsqfttrddilrdwnlirdaatlilsq
Timeline for d4e1oe1: