SCOPe 2.08: Domain d4e1oe1: 4e1o E:2-477

Lineage for d4e1oe1 (4e1o E:2-477)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries)

8. Domain d4e1oe1: 4e1o E:2-477 [201769]
   Other proteins in same PDB: d4e1oa2, d4e1ob2, d4e1oc2, d4e1od2, d4e1oe2, d4e1of2
   automated match to d4e1oc_
   complexed with plp, pvh

Details for d4e1oe1

PDB Entry: 4e1o, 1.8 Å

PDB Description: Human histidine decarboxylase complex with Histidine methyl ester (HME)

PDB Compounds: (E:) histidine decarboxylase

SCOPe Domain Sequences for d4e1oe1:

Sequence; same for both SEQRES and ATOM records:

>d4e1oe1 c.67.1.0 (E:2-477) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mepeeyrergremvdyicqylstvrerrvtpdvqpgylraqlpesapedpdswdsifgdi
eriimpgvvhwqsphmhayypaltswpsllgdmladainclgftwasspactelemnvmd
wlakmlglpehflhhhpssqgggvlqstvsestliallaarknkilemktsepdadessl
narlvayasdqahssvekaglislvkmkflpvddnfslrgealqkaieedkqrglvpvfv
catlgttgvcafdclselgpicareglwlhidaayagtaflcpefrgflkgieyadsftf
npskwmmvhfdctgfwvkdkyklqqtfsvnpiylrhansgvatdfmhwqiplsrrfrsvk
lwfvirsfgvknlqahvrhgtemakyfeslvrndpsfeipakrhlglvvfrlkgpnslte
nvlkeiakagrlflipatiqdkliirftvtsqfttrddilrdwnlirdaatlilsq

Timeline for d4e1oe1:

• d4e1oe1 first appeared in SCOPe 2.03, called d4e1oe_
  
• d4e1oe1 appears in SCOPe 2.07