Lineage for d1mf2m1 (1mf2 M:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363752Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (24 PDB entries)
  8. 363764Domain d1mf2m1: 1mf2 M:1-107 [20176]
    Other proteins in same PDB: d1mf2h1, d1mf2h2, d1mf2l2, d1mf2m2, d1mf2n1, d1mf2n2
    part of Fab F11.2.32 against HIV-1 protease

Details for d1mf2m1

PDB Entry: 1mf2 (more details), 2.6 Å

PDB Description: anti hiv1 protease fab complex

SCOP Domain Sequences for d1mf2m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf2m1 b.1.1.1 (M:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleik

SCOP Domain Coordinates for d1mf2m1:

Click to download the PDB-style file with coordinates for d1mf2m1.
(The format of our PDB-style files is described here.)

Timeline for d1mf2m1: