Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab F11.2.32 (mouse), kappa L chain [48834] (2 PDB entries) |
Domain d1mf2h1: 1mf2 H:1-113 [20175] Other proteins in same PDB: d1mf2h2, d1mf2l2, d1mf2m2, d1mf2n2 |
PDB Entry: 1mf2 (more details), 2.6 Å
SCOP Domain Sequences for d1mf2h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mf2h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain} dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts vtvss
Timeline for d1mf2h1: