SCOPe 2.04: Domain d4dvrl2: 4dvr L:107-212

Lineage for d4dvrl2 (4dvr L:107-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d4dvrl2: 4dvr L:107-212 [201745]
   Other proteins in same PDB: d4dvrg_, d4dvrh1, d4dvrh2, d4dvrl1
   automated match to d1rz7l2
   complexed with 0ly, nag

Details for d4dvrl2

PDB Entry: 4dvr, 2.5 Å

PDB Description: crystal structure of yu2 gp120 core in complex with fab 48d and nbd- 557

PDB Compounds: (L:) Fab 48d light chain

SCOPe Domain Sequences for d4dvrl2:

Sequence; same for both SEQRES and ATOM records:

>d4dvrl2 b.1.1.2 (L:107-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrge

Timeline for d4dvrl2:

• d4dvrl2 first appeared in SCOPe 2.03
  
• d4dvrl2 appears in SCOPe 2.05
  
• d4dvrl2 appears in the current release, SCOPe 2.08