SCOPe 2.07: Domain d4dvrl1: 4dvr L:2-106

Lineage for d4dvrl1 (4dvr L:2-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d4dvrl1: 4dvr L:2-106 [201744]
   Other proteins in same PDB: d4dvrg_, d4dvrh1, d4dvrh2, d4dvrl2
   automated match to d1rz7l1
   complexed with 0ly, nag

Details for d4dvrl1

PDB Entry: 4dvr, 2.5 Å

PDB Description: crystal structure of yu2 gp120 core in complex with fab 48d and nbd- 557

PDB Compounds: (L:) Fab 48d light chain

SCOPe Domain Sequences for d4dvrl1:

Sequence; same for both SEQRES and ATOM records:

>d4dvrl1 b.1.1.1 (L:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
iqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvpsr
fsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveik

Timeline for d4dvrl1:

• d4dvrl1 first appeared in SCOPe 2.03
  
• d4dvrl1 appears in SCOPe 2.06
  
• d4dvrl1 appears in the current release, SCOPe 2.08