| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (19 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
| Domain d4dtgl1: 4dtg L:1-111 [201735] Other proteins in same PDB: d4dtgk_, d4dtgl2 automated match to d1dn0a1 complexed with gol, mes, pge |
PDB Entry: 4dtg (more details), 1.8 Å
SCOPe Domain Sequences for d4dtgl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dtgl1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqtplslsvtpgqpasisckssqsllesdgktylnwylqkpgqspqlliylvsild
sgvpdrfsgsgsgtdftlkisrveaedvgvyyclqathfpqtfgggtkvei
Timeline for d4dtgl1: