SCOPe 2.04: Domain d4dtgl1: 4dtg L:1-111

Lineage for d4dtgl1 (4dtg L:1-111)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4dtgl1: 4dtg L:1-111 [201735]
   Other proteins in same PDB: d4dtgk_, d4dtgl2
   automated match to d1dn0a1
   complexed with gol, mes, pge

Details for d4dtgl1

PDB Entry: 4dtg, 1.8 Å

PDB Description: hemostatic effect of a monoclonal antibody mab 2021 blocking the interaction between fxa and tfpi in a rabbit hemophilia model

PDB Compounds: (L:) Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain

SCOPe Domain Sequences for d4dtgl1:

Sequence; same for both SEQRES and ATOM records:

>d4dtgl1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqtplslsvtpgqpasisckssqsllesdgktylnwylqkpgqspqlliylvsild
sgvpdrfsgsgsgtdftlkisrveaedvgvyyclqathfpqtfgggtkvei

Timeline for d4dtgl1:

• d4dtgl1 first appeared in SCOPe 2.03
  
• d4dtgl1 appears in SCOPe 2.05
  
• d4dtgl1 appears in the current release, SCOPe 2.08