Lineage for d4dtgl1 (4dtg L:1-111)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296064Domain d4dtgl1: 4dtg L:1-111 [201735]
    Other proteins in same PDB: d4dtgk_, d4dtgl2
    automated match to d1dn0a1
    complexed with gol, mes, pge

Details for d4dtgl1

PDB Entry: 4dtg (more details), 1.8 Å

PDB Description: hemostatic effect of a monoclonal antibody mab 2021 blocking the interaction between fxa and tfpi in a rabbit hemophilia model
PDB Compounds: (L:) Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain

SCOPe Domain Sequences for d4dtgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dtgl1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqtplslsvtpgqpasisckssqsllesdgktylnwylqkpgqspqlliylvsild
sgvpdrfsgsgsgtdftlkisrveaedvgvyyclqathfpqtfgggtkvei

SCOPe Domain Coordinates for d4dtgl1:

Click to download the PDB-style file with coordinates for d4dtgl1.
(The format of our PDB-style files is described here.)

Timeline for d4dtgl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dtgl2
View in 3D
Domains from other chains:
(mouse over for more information)
d4dtgk_