SCOP 1.75: Domain d2hrph1: 2hrp H:1-113

Lineage for d2hrph1 (2hrp H:1-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (54 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d2hrph1: 2hrp H:1-113 [20171]
   Other proteins in same PDB: d2hrph2, d2hrpl1, d2hrpl2, d2hrpm1, d2hrpm2, d2hrpn2
   part of Fab F11.2.32 against HIV-1 protease

Details for d2hrph1

PDB Entry: 2hrp, 2.2 Å

PDB Description: antigen-antibody complex

PDB Compounds: (H:) monoclonal antibody f11.2.32

SCOP Domain Sequences for d2hrph1:

Sequence; same for both SEQRES and ATOM records:

>d2hrph1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
vtvss

Timeline for d2hrph1:

• d2hrph1 first appeared (with stable ids) in SCOP 1.55
  
• d2hrph1 appears in SCOP 1.73
  
• d2hrph1 appears in SCOPe 2.01
  
• d2hrph1 appears in the current release, SCOPe 2.08