Lineage for d2hrph1 (2hrp H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362934Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 362948Domain d2hrph1: 2hrp H:1-113 [20171]
    Other proteins in same PDB: d2hrph2, d2hrpl1, d2hrpl2, d2hrpm1, d2hrpm2, d2hrpn2

Details for d2hrph1

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrph1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
vtvss

SCOP Domain Coordinates for d2hrph1:

Click to download the PDB-style file with coordinates for d2hrph1.
(The format of our PDB-style files is described here.)

Timeline for d2hrph1: