![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
![]() | Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (7 PDB entries) |
![]() | Domain d4dhjn_: 4dhj N: [201709] Other proteins in same PDB: d4dhja_, d4dhjb_, d4dhjd_, d4dhje_, d4dhjf_, d4dhjh_, d4dhji_, d4dhjj_, d4dhjl_, d4dhjm_ automated match to d1j7db_ |
PDB Entry: 4dhj (more details), 2.35 Å
SCOPe Domain Sequences for d4dhjn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhjn_ d.20.1.1 (N:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl andvaeqwktneaqaietarawtrlyamnn
Timeline for d4dhjn_: