SCOP 1.55: Domain d1hyyh1: 1hyy H:1-113

Lineage for d1hyyh1 (1hyy H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 6D9 (mouse), kappa L chain [48833] (2 PDB entries)

8. Domain d1hyyh1: 1hyy H:1-113 [20169]
   Other proteins in same PDB: d1hyyh2, d1hyyl2

Details for d1hyyh1

PDB Entry: 1hyy, 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyh1:

Sequence; same for both SEQRES and ATOM records:

>d1hyyh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
evkllesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
ss

Timeline for d1hyyh1:

• d1hyyh1 appears in SCOP 1.57
  
• d1hyyh1 last appears in SCOP 1.73