Lineage for d1hyxh1 (1hyx H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52141Species Fab 6D9 (mouse), kappa L chain [48833] (2 PDB entries)
  8. 52142Domain d1hyxh1: 1hyx H:1-113 [20167]
    Other proteins in same PDB: d1hyxh2, d1hyxl2

Details for d1hyxh1

PDB Entry: 1hyx (more details), 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyxh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
evkllesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
ss

SCOP Domain Coordinates for d1hyxh1:

Click to download the PDB-style file with coordinates for d1hyxh1.
(The format of our PDB-style files is described here.)

Timeline for d1hyxh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyxh2