SCOP 1.71: Domain d1hyxl1: 1hyx L:1-107

Lineage for d1hyxl1 (1hyx L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1hyxl1: 1hyx L:1-107 [20166]
   Other proteins in same PDB: d1hyxh1, d1hyxh2, d1hyxl2
   part of hydrolytic antibody 6D9
   complexed with cpd

Details for d1hyxl1

PDB Entry: 1hyx, 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyxl1:

Sequence; same for both SEQRES and ATOM records:

>d1hyxl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

Timeline for d1hyxl1:

• d1hyxl1 first appeared (with stable ids) in SCOP 1.55
  
• d1hyxl1 appears in SCOP 1.69
  
• d1hyxl1 last appears in SCOP 1.73