Lineage for d2bfvh_ (2bfv H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510801Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1510823Domain d2bfvh_: 2bfv H: [20165]
    Other proteins in same PDB: d2bfvl_
    part of Fv 4155
    complexed with stg

Details for d2bfvh_

PDB Entry: 2bfv (more details), 2.5 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli
PDB Compounds: (H:) fv4155

SCOPe Domain Sequences for d2bfvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss

SCOPe Domain Coordinates for d2bfvh_:

Click to download the PDB-style file with coordinates for d2bfvh_.
(The format of our PDB-style files is described here.)

Timeline for d2bfvh_: