Lineage for d2bfvh_ (2bfv H:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362934Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 362954Domain d2bfvh_: 2bfv H: [20165]
    Other proteins in same PDB: d2bfvl_
    part of Fv 4155
    complexed with stg

Details for d2bfvh_

PDB Entry: 2bfv (more details), 2.5 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli

SCOP Domain Sequences for d2bfvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss

SCOP Domain Coordinates for d2bfvh_:

Click to download the PDB-style file with coordinates for d2bfvh_.
(The format of our PDB-style files is described here.)

Timeline for d2bfvh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bfvl_