Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4d9ql2: 4d9q L:108-213 [201649] Other proteins in same PDB: d4d9qa_, d4d9qb_, d4d9qd1, d4d9ql1 automated match to d3fcta2 complexed with gol, so4, zn |
PDB Entry: 4d9q (more details), 2.28 Å
SCOPe Domain Sequences for d4d9ql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d9ql2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d4d9ql2:
View in 3D Domains from other chains: (mouse over for more information) d4d9qa_, d4d9qb_, d4d9qd1, d4d9qd2 |