Lineage for d4d9ql2 (4d9q L:108-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517596Domain d4d9ql2: 4d9q L:108-213 [201649]
    Other proteins in same PDB: d4d9qa_, d4d9qb_, d4d9qd1, d4d9ql1
    automated match to d3fcta2
    complexed with gol, so4, zn

Details for d4d9ql2

PDB Entry: 4d9q (more details), 2.28 Å

PDB Description: inhibiting alternative pathway complement activation by targeting the exosite on factor d
PDB Compounds: (L:) Anti-Factor D, light chain

SCOPe Domain Sequences for d4d9ql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9ql2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4d9ql2:

Click to download the PDB-style file with coordinates for d4d9ql2.
(The format of our PDB-style files is described here.)

Timeline for d4d9ql2: