Lineage for d2bfvl_ (2bfv L:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653253Domain d2bfvl_: 2bfv L: [20164]
    Other proteins in same PDB: d2bfvh_
    part of Fv 4155
    complexed with stg

Details for d2bfvl_

PDB Entry: 2bfv (more details), 2.5 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli
PDB Compounds: (L:) fv4155

SCOP Domain Sequences for d2bfvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfvl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleik

SCOP Domain Coordinates for d2bfvl_:

Click to download the PDB-style file with coordinates for d2bfvl_.
(The format of our PDB-style files is described here.)

Timeline for d2bfvl_: