Lineage for d1bfvh_ (1bfv H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652445Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (51 PDB entries)
  8. 652458Domain d1bfvh_: 1bfv H: [20163]
    Other proteins in same PDB: d1bfvl_
    part of Fv 4155
    complexed with stg, zn

Details for d1bfvh_

PDB Entry: 1bfv (more details), 2.1 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli
PDB Compounds: (H:) fv4155

SCOP Domain Sequences for d1bfvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss

SCOP Domain Coordinates for d1bfvh_:

Click to download the PDB-style file with coordinates for d1bfvh_.
(The format of our PDB-style files is described here.)

Timeline for d1bfvh_: