SCOPe 2.04: Domain d4bele_: 4bel E:

Lineage for d4bele_ (4bel E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)

8. Domain d4bele_: 4bel E: [201614]
   Other proteins in same PDB: d4bela_, d4belb_
   automated match to d3ezjb_
   complexed with b3p, cl

Details for d4bele_

PDB Entry: 4bel, 1.85 Å

PDB Description: bace2 xaperone complex

PDB Compounds: (E:) xa4813

SCOPe Domain Sequences for d4bele_:

Sequence; same for both SEQRES and ATOM records:

>d4bele_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvssh

Timeline for d4bele_:

• d4bele_ first appeared in SCOPe 2.03
  
• d4bele_ appears in SCOPe 2.05
  
• d4bele_ appears in the current release, SCOPe 2.08, called d4bele1