SCOPe 2.06: Domain d4bcpb2: 4bcp B:309-432

Lineage for d4bcpb2 (4bcp B:309-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (10 PDB entries)

8. Domain d4bcpb2: 4bcp B:309-432 [201610]
   Other proteins in same PDB: d4bcpa1, d4bcpa2, d4bcpc1, d4bcpc2
   automated match to d2cchb2
   complexed with sgm, so4, t3c

Details for d4bcpb2

PDB Entry: 4bcp, 2.26 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4bcpb2:

Sequence; same for both SEQRES and ATOM records:

>d4bcpb2 a.74.1.1 (B:309-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

Timeline for d4bcpb2:

• d4bcpb2 first appeared in SCOPe 2.03
  
• d4bcpb2 appears in SCOPe 2.05
  
• d4bcpb2 appears in SCOPe 2.07
  
• d4bcpb2 appears in the current release, SCOPe 2.08