Lineage for d4bcpb2 (4bcp B:309-432)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1274277Protein automated matches [227027] (3 species)
    not a true protein
  7. 1274291Species Human (Homo sapiens) [TaxId:9606] [225840] (4 PDB entries)
  8. 1274301Domain d4bcpb2: 4bcp B:309-432 [201610]
    Other proteins in same PDB: d4bcpa_, d4bcpc_
    automated match to d2cchb2
    complexed with sgm, so4, t3c

Details for d4bcpb2

PDB Entry: 4bcp (more details), 2.26 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4bcpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcpb2 a.74.1.1 (B:309-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOPe Domain Coordinates for d4bcpb2:

Click to download the PDB-style file with coordinates for d4bcpb2.
(The format of our PDB-style files is described here.)

Timeline for d4bcpb2: