Lineage for d4b9kl_ (4b9k L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041766Protein automated matches [193392] (1 species)
    not a true protein
  7. 2041767Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2041771Domain d4b9kl_: 4b9k L: [201601]
    Other proteins in same PDB: d4b9ka_, d4b9kb1, d4b9kb2, d4b9kd_, d4b9ke_, d4b9kg_, d4b9kh_, d4b9kj_, d4b9kk1, d4b9kk2
    automated match to d4b9ki_
    complexed with act, tg0

Details for d4b9kl_

PDB Entry: 4b9k (more details), 2 Å

PDB Description: pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4b9kl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b9kl_ b.3.3.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqeria

SCOPe Domain Coordinates for d4b9kl_:

Click to download the PDB-style file with coordinates for d4b9kl_.
(The format of our PDB-style files is described here.)

Timeline for d4b9kl_: