Lineage for d1cfvl_ (1cfv L:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104576Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 1104627Domain d1cfvl_: 1cfv L: [20160]
    Other proteins in same PDB: d1cfvh_
    part of Fv 4155
    complexed with e3g, zn

Details for d1cfvl_

PDB Entry: 1cfv (more details), 2.1 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli
PDB Compounds: (L:) monoclonal antibody fv4155

SCOPe Domain Sequences for d1cfvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfvl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr

SCOPe Domain Coordinates for d1cfvl_:

Click to download the PDB-style file with coordinates for d1cfvl_.
(The format of our PDB-style files is described here.)

Timeline for d1cfvl_: