Lineage for d1cfvl_ (1cfv L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7881Species Fv 4155 (mouse), kappa L chain [48832] (3 PDB entries)
  8. 7883Domain d1cfvl_: 1cfv L: [20160]

Details for d1cfvl_

PDB Entry: 1cfv (more details), 2.1 Å

PDB Description: monoclonal antibody fragment fv4155 from e. coli

SCOP Domain Sequences for d1cfvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfvl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv 4155 (mouse), kappa L chain}
dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr

SCOP Domain Coordinates for d1cfvl_:

Click to download the PDB-style file with coordinates for d1cfvl_.
(The format of our PDB-style files is described here.)

Timeline for d1cfvl_: