Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein automated matches [193392] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
Domain d4b9kf_: 4b9k F: [201596] Other proteins in same PDB: d4b9ka_, d4b9kb_, d4b9kd_, d4b9ke_, d4b9kg_, d4b9kh_, d4b9kj_, d4b9kk_ automated match to d4b9ki_ complexed with act, tg0 |
PDB Entry: 4b9k (more details), 2 Å
SCOPe Domain Sequences for d4b9kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b9kf_ b.3.3.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d4b9kf_: