SCOP 1.55: Domain d1yehl1: 1yeh L:1-107

Lineage for d1yehl1 (1yeh L:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab D2.5 (mouse), kappa L chain [48831] (4 PDB entries)

8. Domain d1yehl1: 1yeh L:1-107 [20158]
   Other proteins in same PDB: d1yehh2, d1yehl2

Details for d1yehl1

PDB Entry: 1yeh, 2.55 Å

PDB Description: structure of igg2a fab fragment

SCOP Domain Sequences for d1yehl1:

Sequence; same for both SEQRES and ATOM records:

>d1yehl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

Timeline for d1yehl1:

• d1yehl1 appears in SCOP 1.57
  
• d1yehl1 appears in the current release, SCOPe 2.08