Lineage for d1yeeh1 (1yee H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652632Domain d1yeeh1: 1yee H:1-113 [20157]
    Other proteins in same PDB: d1yeeh2, d1yeel1, d1yeel2
    part of Fab D2.5
    complexed with pnb

Details for d1yeeh1

PDB Entry: 1yee (more details), 2.2 Å

PDB Description: structure of a catalytic antibody, igg2a fab fragment (d2.5)
PDB Compounds: (H:) igg2a fab fragment (d2.5)

SCOP Domain Sequences for d1yeeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeeh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evklqesgaelvrpgasvklscktsgyiftsywihwvkqraaaglewiariypgtgssyy
nvkfkgkatltadkssstaymqlsslksddsavyfcvrwgfipvredyvldywgqgtlvt
vss

SCOP Domain Coordinates for d1yeeh1:

Click to download the PDB-style file with coordinates for d1yeeh1.
(The format of our PDB-style files is described here.)

Timeline for d1yeeh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yeeh2