SCOPe 2.03: Domain d4b1td_: 4b1t D:

Lineage for d4b1td_ (4b1t D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein automated matches [190792] (2 species)
   not a true protein

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries)

8. Domain d4b1td_: 4b1t D: [201552]
   Other proteins in same PDB: d4b1ta_, d4b1tc_
   automated match to d4b1tb_
   complexed with ca, edo, gol

Details for d4b1td_

PDB Entry: 4b1t, 1.78 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (ta) in complex with eglin c

PDB Compounds: (D:) eglin c

SCOPe Domain Sequences for d4b1td_:

Sequence; same for both SEQRES and ATOM records:

>d4b1td_ d.40.1.1 (D:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvv
nhvphvg

Timeline for d4b1td_:

• d4b1td_ is new in SCOPe 2.03-stable
  
• d4b1td_ appears in SCOPe 2.04
  
• d4b1td_ appears in the current release, SCOPe 2.08