Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries) |
Domain d4awjh_: 4awj H: [201535] Other proteins in same PDB: d4awja_, d4awjc_, d4awjd_, d4awjf_, d4awjg_, d4awji_, d4awjj_, d4awjk2, d4awjl_ automated match to d2c9wc_ complexed with act, acy, gol, v6f |
PDB Entry: 4awj (more details), 2.5 Å
SCOPe Domain Sequences for d4awjh_:
Sequence, based on SEQRES records: (download)
>d4awjh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d4awjh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d4awjh_: