Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein automated matches [193392] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
Domain d4awjc_: 4awj C: [201533] Other proteins in same PDB: d4awja_, d4awjb_, d4awjd_, d4awje_, d4awjg_, d4awjh_, d4awjj_, d4awjk_ automated match to d4awjf_ complexed with act, acy, gol, v6f |
PDB Entry: 4awj (more details), 2.5 Å
SCOPe Domain Sequences for d4awjc_:
Sequence, based on SEQRES records: (download)
>d4awjc_ b.3.3.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdler
>d4awjc_ b.3.3.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvpifanitlpvytlkerclqvvrslvkpenyrrldivrsl yedledhpnvqkdler
Timeline for d4awjc_: