![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries) Uniprot P19483 |
![]() | Domain d4asuc2: 4asu C:95-379 [201520] Other proteins in same PDB: d4asua1, d4asua3, d4asub1, d4asub3, d4asuc1, d4asuc3, d4asud1, d4asud2, d4asud3, d4asue1, d4asue2, d4asue3, d4asuf1, d4asuf2, d4asuf3, d4asug_, d4asui_ automated match to d1w0ja3 complexed with adp, mg |
PDB Entry: 4asu (more details), 2.6 Å
SCOPe Domain Sequences for d4asuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4asuc2 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d4asuc2: