Lineage for d1yeda1 (1yed A:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653316Domain d1yeda1: 1yed A:1-107 [20150]
    Other proteins in same PDB: d1yeda2, d1yedb1, d1yedb2, d1yedh1, d1yedh2, d1yedl2
    part of Fab D2.4
    complexed with pnb

Details for d1yeda1

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)
PDB Compounds: (A:) igg1 fab fragment (d.2.4)

SCOP Domain Sequences for d1yeda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeda1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskle
sgvpdrftgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

SCOP Domain Coordinates for d1yeda1:

Click to download the PDB-style file with coordinates for d1yeda1.
(The format of our PDB-style files is described here.)

Timeline for d1yeda1: