Lineage for d1yekl1 (1yek L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653228Domain d1yekl1: 1yek L:1-107 [20146]
    Other proteins in same PDB: d1yekh1, d1yekh2, d1yekl2
    part of Fab D2.3
    complexed with pnp, zn

Details for d1yekl1

PDB Entry: 1yek (more details), 2.1 Å

PDB Description: catalytic antibody d2.3 complex
PDB Compounds: (L:) protein (ig antibody d2.3 (light chain))

SCOP Domain Sequences for d1yekl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yekl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

SCOP Domain Coordinates for d1yekl1:

Click to download the PDB-style file with coordinates for d1yekl1.
(The format of our PDB-style files is described here.)

Timeline for d1yekl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yekl2