Lineage for d1yech1 (1yec H:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158119Species Fab D2.3 (mouse), kappa L chain [48829] (6 PDB entries)
  8. 158124Domain d1yech1: 1yec H:1-113 [20145]
    Other proteins in same PDB: d1yech2, d1yecl2

Details for d1yech1

PDB Entry: 1yec (more details), 1.9 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.3)

SCOP Domain Sequences for d1yech1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yech1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab D2.3 (mouse), kappa L chain}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

SCOP Domain Coordinates for d1yech1:

Click to download the PDB-style file with coordinates for d1yech1.
(The format of our PDB-style files is described here.)

Timeline for d1yech1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yech2