SCOPe 2.05: Domain d4aeil1: 4aei L:1-112

Lineage for d4aeil1 (4aei L:1-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d4aeil1: 4aei L:1-112 [201416]
   Other proteins in same PDB: d4aeia_, d4aeib_, d4aeic_, d4aeil2, d4aeim2, d4aein2
   automated match to d1blna1
   complexed with cl, epe

Details for d4aeil1

PDB Entry: 4aei, 2.3 Å

PDB Description: Crystal structure of the AaHII-Fab4C1 complex

PDB Compounds: (L:) fab antibody light chain

SCOPe Domain Sequences for d4aeil1:

Sequence; same for both SEQRES and ATOM records:

>d4aeil1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelk

Timeline for d4aeil1:

• d4aeil1 first appeared in SCOPe 2.03
  
• d4aeil1 appears in SCOPe 2.04
  
• d4aeil1 appears in SCOPe 2.06
  
• d4aeil1 appears in the current release, SCOPe 2.08