Lineage for d1yejh1 (1yej H:1-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7622Species Fab D2.3 (mouse), kappa L chain [48829] (4 PDB entries)
  8. 7623Domain d1yejh1: 1yej H:1-113 [20141]
    Other proteins in same PDB: d1yejh2, d1yejl2

Details for d1yejh1

PDB Entry: 1yej (more details), 1.85 Å

PDB Description: catalytic antibody complex

SCOP Domain Sequences for d1yejh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yejh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab D2.3 (mouse), kappa L chain}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

SCOP Domain Coordinates for d1yejh1:

Click to download the PDB-style file with coordinates for d1yejh1.
(The format of our PDB-style files is described here.)

Timeline for d1yejh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yejh2