SCOPe 2.08: Domain d4a1ya1: 4a1y A:0-131

Lineage for d4a1ya1 (4a1y A:0-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries)

8. Domain d4a1ya1: 4a1y A:0-131 [201394]
   Other proteins in same PDB: d4a1ya2, d4a1yb2, d4a1yc2, d4a1yd2
   automated match to d4a1yc_
   complexed with cl, plm; mutant

Details for d4a1ya1

PDB Entry: 4a1y, 1.2 Å

PDB Description: human myelin p2 protein, k65q mutant

PDB Compounds: (A:) myelin p2 protein

SCOPe Domain Sequences for d4a1ya1:

Sequence; same for both SEQRES and ATOM records:

>d4a1ya1 b.60.1.2 (A:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestfkn
teisfqlgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

Timeline for d4a1ya1:

• d4a1ya1 first appeared in SCOPe 2.03, called d4a1ya_
  
• d4a1ya1 appears in SCOPe 2.07