SCOP 1.57: Domain d1pskh1: 1psk H:1-114

Lineage for d1pskh1 (1psk H:1-114)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab against a ganglioside (mouse), kappa L chain [48828] (1 PDB entry)

8. Domain d1pskh1: 1psk H:1-114 [20139]
   Other proteins in same PDB: d1pskh2, d1pskl2

Details for d1pskh1

PDB Entry: 1psk, 2.8 Å

PDB Description: the crystal structure of an fab fragment that binds to the melanoma-associated gd2 ganglioside

SCOP Domain Sequences for d1pskh1:

Sequence; same for both SEQRES and ATOM records:

>d1pskh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab against a ganglioside (mouse), kappa L chain}
evqlqqsgpelvkpgasvkiscktsgytftkytmhwvkqshgkslewigdinpnnggtny
nqkfkgtatltvhkssttaymelrsltsedsavyyctsksfdywgqgttltvss

Timeline for d1pskh1:

• d1pskh1 first appeared (with stable ids) in SCOP 1.55
  
• d1pskh1 appears in SCOP 1.59
  
• d1pskh1 appears in the current release, SCOPe 2.07