SCOP 1.75: Domain d1pskl1: 1psk L:1-106

Lineage for d1pskl1 (1psk L:1-106)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1pskl1: 1psk L:1-106 [20138]
   Other proteins in same PDB: d1pskh1, d1pskh2, d1pskl2
   part of antibody against the melanoma associated gd2 ganglioside

Details for d1pskl1

PDB Entry: 1psk, 2.8 Å

PDB Description: the crystal structure of an fab fragment that binds to the melanoma-associated gd2 ganglioside

PDB Compounds: (L:) antibody

SCOP Domain Sequences for d1pskl1:

Sequence; same for both SEQRES and ATOM records:

>d1pskl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qivltqspaimsaspgekvtitcsasssvsnihwfqqkpgtfpklwiyststlasgvpgr
fsgsgsgtsysltisrmgaedaatyycqqrsgypftfgsgtkleik

Timeline for d1pskl1:

• d1pskl1 first appeared (with stable ids) in SCOP 1.55
  
• d1pskl1 appears in SCOP 1.73
  
• d1pskl1 appears in SCOPe 2.01
  
• d1pskl1 appears in the current release, SCOPe 2.08