Lineage for d1pskl1 (1psk L:1-106)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52165Species Fab against a ganglioside (mouse), kappa L chain [48828] (1 PDB entry)
  8. 52167Domain d1pskl1: 1psk L:1-106 [20138]
    Other proteins in same PDB: d1pskh2, d1pskl2

Details for d1pskl1

PDB Entry: 1psk (more details), 2.8 Å

PDB Description: the crystal structure of an fab fragment that binds to the melanoma-associated gd2 ganglioside

SCOP Domain Sequences for d1pskl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pskl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab against a ganglioside (mouse), kappa L chain}
qivltqspaimsaspgekvtitcsasssvsnihwfqqkpgtfpklwiyststlasgvpgr
fsgsgsgtsysltisrmgaedaatyycqqrsgypftfgsgtkleik

SCOP Domain Coordinates for d1pskl1:

Click to download the PDB-style file with coordinates for d1pskl1.
(The format of our PDB-style files is described here.)

Timeline for d1pskl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pskl2