Lineage for d1qkzh1 (1qkz H:1-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7784Species Fab MN14C11.6 (mouse), kappa L chain [48827] (1 PDB entry)
  8. 7785Domain d1qkzh1: 1qkz H:1-113 [20137]
    Other proteins in same PDB: d1qkza_, d1qkzh2, d1qkzl2

Details for d1qkzh1

PDB Entry: 1qkz (more details), 1.95 Å

PDB Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g

SCOP Domain Sequences for d1qkzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkzh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab MN14C11.6 (mouse), kappa L chain}
dvklvesggglvkpgrslklscaasgftfsdyymfwvrqtpeqrlewvatisdggaytyy
pdsvkgrftisrdnaknnlylqmnslksedtgmyycardpleyygmdywgqgtsvavss

SCOP Domain Coordinates for d1qkzh1:

Click to download the PDB-style file with coordinates for d1qkzh1.
(The format of our PDB-style files is described here.)

Timeline for d1qkzh1: