SCOPe 2.08: Domain d3zo0a2: 3zo0 A:340-444

Lineage for d3zo0a2 (3zo0 A:340-444)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3zo0a2: 3zo0 A:340-444 [201355]
   Other proteins in same PDB: d3zo0b1, d3zo0b2
   automated match to d2ql1a2
   complexed with fuc, man

Details for d3zo0a2

PDB Entry: 3zo0, 1.99 Å

PDB Description: mouse igg2a in complex with mouse trim21 pryspry

PDB Compounds: (A:) ig gamma-2a chain c region, a allele

SCOPe Domain Sequences for d3zo0a2:

Sequence; same for both SEQRES and ATOM records:

>d3zo0a2 b.1.1.0 (A:340-444) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvld
sdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrs

Timeline for d3zo0a2:

• d3zo0a2 first appeared in SCOPe 2.03
  
• d3zo0a2 appears in SCOPe 2.07