Lineage for d1mpal1 (1mpa L:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653269Domain d1mpal1: 1mpa L:1-112 [20134]
    Other proteins in same PDB: d1mpah1, d1mpah2, d1mpal2
    part of bactericidal Fab MN12H2 against Neisseria meningitidis
    complexed with cd, cyf, thc

Details for d1mpal1

PDB Entry: 1mpa (more details), 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis
PDB Compounds: (L:) mn12h2 igg2a-kappa

SCOP Domain Sequences for d1mpal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpal1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

SCOP Domain Coordinates for d1mpal1:

Click to download the PDB-style file with coordinates for d1mpal1.
(The format of our PDB-style files is described here.)

Timeline for d1mpal1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mpal2