Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries) against Neisseria meningitidis |
Domain d1mpal1: 1mpa L:1-112 [20134] Other proteins in same PDB: d1mpah2, d1mpal2 |
PDB Entry: 1mpa (more details), 2.6 Å
SCOP Domain Sequences for d1mpal1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpal1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain} divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik
Timeline for d1mpal1: