Lineage for d1afvk1 (1afv K:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52029Species Fab 25.3 (mouse), kappa L chain [48825] (1 PDB entry)
  8. 52031Domain d1afvk1: 1afv K:1-120 [20133]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh2, d1afvk2, d1afvl2, d1afvm2

Details for d1afvk1

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvk1 b.1.1.1 (K:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
qvqlqqpgsvlvrpgasvklsckasgytftsswihwakqrpgqglewigeihpnsgntny
nekfkgkatltvdtssstayvdlssltsedsavyycarwrygspyyfdywgqgttltvss

SCOP Domain Coordinates for d1afvk1:

Click to download the PDB-style file with coordinates for d1afvk1.
(The format of our PDB-style files is described here.)

Timeline for d1afvk1: