SCOPe 2.06: Domain d3zkje_: 3zkj E:

Lineage for d3zkje_ (3zkj E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries)

8. Domain d3zkje_: 3zkj E: [201329]
   Other proteins in same PDB: d3zkjc_, d3zkjf_
   complexed with cl, edo, peg

Details for d3zkje_

PDB Entry: 3zkj, 2.58 Å

PDB Description: crystal structure of ankyrin repeat and socs box-containing protein 9 (asb9) in complex with elonginb and elonginc

PDB Compounds: (E:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d3zkje_:

Sequence, based on SEQRES records:

>d3zkje_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyf
tykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d3zkje_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlevnfreipshvlskvcmyftykvrytnseip
efpiapeialellmaanfldc

Timeline for d3zkje_:

• d3zkje_ first appeared in SCOPe 2.03
  
• d3zkje_ appears in SCOPe 2.05
  
• d3zkje_ appears in SCOPe 2.07
  
• d3zkje_ appears in the current release, SCOPe 2.08