SCOPe 2.08: Domain d3zkjc_: 3zkj C:

Lineage for d3zkjc_ (3zkj C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d3zkjc_: 3zkj C: [201328]
   Other proteins in same PDB: d3zkjb_, d3zkje_
   complexed with cl, edo, peg
   fragment; missing more than one-third of the common structure and/or sequence

Details for d3zkjc_

PDB Entry: 3zkj, 2.58 Å

PDB Description: crystal structure of ankyrin repeat and socs box-containing protein 9 (asb9) in complex with elonginb and elonginc

PDB Compounds: (C:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zkjc_:

Sequence, based on SEQRES records:

>d3zkjc_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmkp

Sequence, based on observed residues (ATOM records):

>d3zkjc_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakstvfelkrivegilkrppkddqlftsqtarpqapatvepfss
ppelpdvmkp

Timeline for d3zkjc_:

• d3zkjc_ first appeared in SCOPe 2.03
  
• d3zkjc_ appears in SCOPe 2.07