Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 25.3 (mouse), kappa L chain [48825] (1 PDB entry) against HIV-1 capsid protein (p24) |
Domain d1afvm1: 1afv M:1-112 [20132] Other proteins in same PDB: d1afva_, d1afvb_, d1afvh2, d1afvk2, d1afvl2, d1afvm2 |
PDB Entry: 1afv (more details), 3.7 Å
SCOP Domain Sequences for d1afvm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afvm1 b.1.1.1 (M:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 25.3 (mouse), kappa L chain} divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkr
Timeline for d1afvm1: