Lineage for d1afvm1 (1afv M:1-112)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102381Species Fab 25.3 (mouse), kappa L chain [48825] (1 PDB entry)
  8. 102385Domain d1afvm1: 1afv M:1-112 [20132]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh2, d1afvk2, d1afvl2, d1afvm2

Details for d1afvm1

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvm1 b.1.1.1 (M:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkr

SCOP Domain Coordinates for d1afvm1:

Click to download the PDB-style file with coordinates for d1afvm1.
(The format of our PDB-style files is described here.)

Timeline for d1afvm1: