Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (42 species) not a true protein |
Species Escherichia coli [TaxId:562] [196657] (1 PDB entry) |
Domain d3zhwb_: 3zhw B: [201319] automated match to d3zhwa_ complexed with hem, so4 |
PDB Entry: 3zhw (more details), 2.22 Å
SCOPe Domain Sequences for d3zhwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zhwb_ a.1.1.2 (B:) automated matches {Escherichia coli [TaxId: 562]} vfteeqealvvkswsvmkknsaelglklfikifeiapttkkmfsflrdspipaeqnpklk phamsvfvmccesavqlrktgkvtvrettlkrlgashskygvvdehfevakyalletike avpemwspemkvawgqaydhlvaaikaemnlsn
Timeline for d3zhwb_: